S100B Antibody (CL2720)

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-46626

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-46626
NBP2-46626-25ul
Generate Quote
Bulk Order
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Validated:

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 Clone # CL2720

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all S100B Antibodies »

Product Summary for S100B Antibody (CL2720)

Immunogen

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence LEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Mouse-On-Mouse blocking reagent may be needed for IHC and ICC experiments to reduce high background signal. You can find these reagents under catalog numbers PK-2200-NB and MP-2400-NB. Please contact Technical Support if you have any questions

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1

Scientific Data Images for S100B Antibody (CL2720)

Immunohistochemistry-Paraffin: S100B Antibody (CL2720) [NBP2-46626] - Staining in human cerebral cortex and kidney tissues. Corresponding S100B RNA-seq data are presented for the same tissues.
Western Blot: S100B Antibody (CL2720) [NBP2-46626] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Human Cerebral Cortex tissue
Immunohistochemistry: S100B Antibody (CL2720) [NBP2-46626] - Staining of rat brain shows moderate positivity in astrocytes in the hippocampus.
View 5 more images

Applications for S100B Antibody (CL2720)

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500-1:1000

Western Blot

1 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: S100B

S100B is a zinc- and calcium-binding protein belonging to the S100 protein family within the EF-hand (helix E-loop-helix F) subgroup (1,2). S100B plays a role in normal central nervous system development, is associated with various neurological diseases such as Alzheimer's and Parkinson's, and it serves as a marker for brain injury (1,2). The S100B protein has a homodimeric structure comprised of two 91-amino acid polypeptide monomers each with a theoretical molecular weight of 10.5 kDa (1,2). Furthermore, each monomer contains two EF-hand regions, four helixes, and a hinge region (2). S100B is predominately expressed in astrocytes, oligodendrocytes, and Schwann cells, but also other cell types including adipocytes (1,3). S100B interacts with toll-like receptor 4 (TLR4) and receptor for advanced glycation end products (RAGE), initiating downstream signaling cascades and transcription factors including JNK/JUN, NFkappaB, and p38, leading to caspase and proinflammatory cytokine production (2). Overall outcomes include neuronal apoptosis, neuroinflammation, and neurodegeneration (1,2). S100B is the most commonly studied astroglia and blood brain barrier biomarker in traumatic brain injury (TBI) (3,4). The serum levels of S100B in patients with TBI is indicative of patient outcomes, where high levels correlate with injury severity and mortality (4). S100B is often in used in combination with additional biomarkers such as glial fibrillary acidic protein (GFAP) and ubiquitin c-terminal hydrolase L1 (UCH-L1) (3,4).

References

1. Yardan, T., Erenler, A. K., Baydin, A., Aydin, K., & Cokluk, C. (2011). Usefulness of S100B protein in neurological disorders. JPMA. The Journal of the Pakistan Medical Association, 61(3), 276-281.

2. Langeh, U., & Singh, S. (2021). Targeting S100B Protein as a Surrogate Biomarker and its Role in Various Neurological Disorders. Current neuropharmacology, 19(2), 265-277. https://doi.org/10.2174/1570159X18666200729100427

3. Thelin, E. P., Nelson, D. W., & Bellander, B. M. (2017). A review of the clinical utility of serum S100B protein levels in the assessment of traumatic brain injury. Acta neurochirurgica, 159(2), 209-225. https://doi.org/10.1007/s00701-016-3046-3

4. Wang, K. K., Yang, Z., Zhu, T., Shi, Y., Rubenstein, R., Tyndall, J. A., & Manley, G. T. (2018). An update on diagnostic and prognostic biomarkers for traumatic brain injury. Expert review of molecular diagnostics, 18(2), 165-180. https://doi.org/10.1080/14737159.2018.1428089

Long Name

S100 Calcium Binding Protein B

Alternate Names

beta (neural), NEF, S100, S100 beta, S100 calcium binding protein B, S100 calcium-binding protein B, S100 calcium-binding protein, beta (neural), S-100 calcium-binding protein, beta chain, 10protein S100-B, S-100 protein beta chain, S-100 protein subunit beta, S100beta

Entrez Gene IDs

6285 (Human)

Gene Symbol

S100B

UniProt

P04271 (Human)

Additional S100B Products

Product Documents for S100B Antibody (CL2720)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for S100B Antibody (CL2720)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.