Skip to main content

Key Product Details

Species Reactivity

SARS-CoV, SARS-CoV-2

Applications

Direct ELISA, ELISA, Immunoassay, Immunocytochemistry/ Immunofluorescence, Western Blot

Label

DyLight 650 (Excitation = 652 nm, Emission = 672 nm)

Antibody Source

Monoclonal Mouse IgG Clone # AP201054

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

The antibody was developed by immunizing mice with a with a protein fragment corresponding to amino acids 1-49 (C-MSDNGPQSNQRSAPRITFGGPTDSTDNNQNGGRNGARPKQRRPQGLPNN) from the N (SARS Nucleocapsid) for the Human SARS coronavirus (Genbank accession no. NP_828858.1)

Reactivity Notes

Use in SARS-CoV-2 reported in scientific literature (PMID:34944502) This antibody was selected for its ability to detect COVID-19 & SARS Coronavirus Nucleoprotein (NP) in direct ELISA. Immunogen displays the following percentage of sequence identity for non-tested species: COVID-19 (84%).

Clonality

Monoclonal

Host

Mouse

Isotype

IgG

Applications for SARS Nucleocapsid Protein Antibody (AP201054) [DyLight 650]

Application
Recommended Usage

Direct ELISA

Optimal dilutions of this antibody should be experimentally determined.

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Immunoassay

Optimal dilutions of this antibody should be experimentally determined.

Immunocytochemistry/ Immunofluorescence

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Protein G purified

Formulation

50mM Sodium Borate

Preservative

0.05% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C in the dark.

Background: SARS Nucleocapsid Protein

It has recently been shown that SARS is caused by a human coronavirus. Human coronaviruses are the major cause of upper respiratory tract illness in humans, such as the common cold. Coronaviruses are positive-stranded RNA viruses, featuring the largest viral RNA genomes known to date (27-31 kb). The first step in coronavirus infection is binding of the viral spike protein, a 139-kDa protein, to certain receptors on host cells. The spike protein is the main surface antigen of the coronavirus. The most prominent protein in the culture supernatants infected with SARS virus is a 46 kDa nucleocapsid protein. This suggests that the nucleocapsid protein is a major immunogen that may be useful for early diagnostics.

Alternate Names

N, N protein, N structural protein, NC, Nucleocapsid protein, Nucleoprotein, Protein N, SARS coronavirus N protein, SARS coronavirus nucleocapsid protein, SARS CoV, SARS CoV N protein, SARS CoV nucleocapsid protein, SARS N protein, SARS Nucleoprotein, SARSCoV, SARSCoV N protein, SARSCoV nucleocapsid protein, Severe acute respiratory syndrome

Gene Symbol

N

Additional SARS Nucleocapsid Protein Products

Product Documents for SARS Nucleocapsid Protein Antibody (AP201054) [DyLight 650]

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for SARS Nucleocapsid Protein Antibody (AP201054) [DyLight 650]



DyLight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...