Klotho-derived peptide 6

Name: Klotho-derived peptide 6
Brand: Tocris Bioscience
SKU: 7847

Tocris Bioscience, part of Bio-Techne | Catalog # 7847

COA / SDS

Wnt/β-catenin signaling inhibitor

Key Product Details

Description:	Wnt/β-catenin signaling inhibitor
Purity:	≥95% (HPLC)
Molecular Weight:	3491.87

View Full Technical Details for Klotho-derived peptide 6

Technical Data
Citations

Biological Activity for Klotho-derived peptide 6

Klotho-derived peptide 6 is a β-catenin signaling inhibitor. Binds to and sequesters Wnt ligands in vitro; prevents expression of Wnt1-induced fibronectin and α-smooth muscle action. In an in vivo mouse model of diabetic kidney disease, Klotho-derived peptide 6 reduces kidney injury, improves survival and prevents accumulation of fibronectin and collagen IV in glomeruli.

Technical Data for Klotho-derived peptide 6

M. Wt	3491.87
Formula	C₁₅₉H₂₃₂N₄₆O₄₄
Single Letter Sequence	QPVVTLYHWDLPQRLQDAYGGWANRALADH
Storage	Store at -20°C
Purity	≥95% (HPLC)
CAS Number	2102414-23-1
InChi Key	BQDMNXDIAPCSQW-XCQHBGKYSA-N
Smiles	O=C(N1[C@@H](CCC1)C(N[C@@H](C(C)C)C(N[C@@H](C(C)C)C(N[C@@H]([C@H](O)C)C(N[C@@H](CC(C)C)C(N[C@@H](CC2=CC=C(C=C2)O)C(N[C@@H](CC3=CNC=N3)C(N[C@@H](CC4=CNC5=CC=CC=C45)C(N[C@@H](CC(O)=O)C(N[C@@H](CC(C)C)C(N6[C@@H](CCC6)C(N[C@@H](CCC(N)=O)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CC(C)C)C(N[C@@H](CCC(N)=O)C(N[C@@H](CC(O)=O)C(N[C@@H](C)C(N[C@@H](CC7=CC=C(C=C7)O)C(NCC(NCC(N[C@@H](CC8=CNC9=CC=CC=C89)C(N[C@@H](C)C(N[C@@H](CC(N)=O)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](C)C(N[C@@H](CC(C)C)C(N[C@@H](C)C(N[C@@H](CC(O)=O)C(N[C@@H](CC%10=CNC=N%10)C(O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)[C@H](CCC(N)=O)N

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility for Klotho-derived peptide 6

Solubility

Soluble to 1mg/ml in water

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Dilution Calculator

Calculate the dilution required to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration

References for Klotho-derived peptide 6

References are publications that support the biological activity of the product.

Chen Klotho-derived peptide 6 ameliorates diabetic kidney disease by targeting Wnt/β-catenin signaling. Kidney Int. 2022 PMID: 35644285